Lineage for d1xjba_ (1xjb A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sitesSuperfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
Common fold covers whole protein structure
Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species) Species Human (Homo sapiens), type III [TaxId:9606] [69383] (5 PDB entries)
bile acid binding protein
Domain d1xjba_: 1xjb A: [122032]
automated match to d1j96a_
complexed with act, bme, cit, edo, nap, so4
Details for d1xjba_
PDB Entry: 1xjb (more details), 1.9 Å
PDB Description: crystal structure of human type 3 3alpha-hydroxysteroid dehydrogenase in complex with nadp(h), citrate and acetate molecules
PDB Compounds: (A:) Aldo-keto reductase family 1 member C2SCOPe Domain Sequences for d1xjba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xjba_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
svddskyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynne
eqvglairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihf
pvsvkpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemiln
kpglkykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlled
pvlcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidg
lnrnvryltldifagppnypfsdey
SCOPe Domain Coordinates for d1xjba_:
Click to download the PDB-style file with coordinates for d1xjba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xjba_:
- d1xjba_ first appeared in SCOP 1.73, called d1xjba1
- d1xjba_ appears in SCOPe 2.02
- d1xjba_ appears in SCOPe 2.04
- d1xjba_ appears in the current release, SCOPe 2.08, called d1xjba2
View in 3D
