Lineage for d1xhfb_ (1xhf B:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.0: automated matches [191324] (1 protein)
not a true familyProtein automated matches [190131] (54 species)
not a true protein
Species Escherichia coli [TaxId:562] [186855] (6 PDB entries) 
Domain d1xhfb_: 1xhf B: [122004]
automated match to d1mvoa_
complexed with bef, bf2, bf4, mg
Details for d1xhfb_
PDB Entry: 1xhf (more details), 2.15 Å
PDB Description: crystal structure of the bef3-activated receiver domain of redox response regulator arca
PDB Compounds: (B:) Aerobic respiration control protein arcASCOPe Domain Sequences for d1xhfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xhfb_ c.23.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mqtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgk
nglllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsr
tm
SCOPe Domain Coordinates for d1xhfb_:
Click to download the PDB-style file with coordinates for d1xhfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xhfb_:
- d1xhfb_ first appeared in SCOP 1.73, called d1xhfb1
- d1xhfb_ appears in SCOPe 2.03
- d1xhfb_ appears in SCOPe 2.05
- d1xhfb_ appears in the current release, SCOPe 2.08
View in 3D
