Lineage for d1xhfb1 (1xhf B:2-122)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691583Protein Aerobic respiration control protein ArcA, N-terminal domain [142035] (1 species)
  7. 691584Species Escherichia coli [TaxId:562] [142036] (2 PDB entries)
  8. 691586Domain d1xhfb1: 1xhf B:2-122 [122004]
    automatically matched to 1XHE A:2-122
    complexed with bef, bf2, bf4, mg; mutant

Details for d1xhfb1

PDB Entry: 1xhf (more details), 2.15 Å

PDB Description: Crystal structure of the bef3-activated receiver domain of redox response regulator arca
PDB Compounds: (B:) Aerobic respiration control protein arcA

SCOP Domain Sequences for d1xhfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xhfb1 c.23.1.1 (B:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]}
qtphilivedelvtrntlksifeaegydvfeatdgaemhqilseydinlvimdinlpgkn
glllarelreqanvalmfltgrdnevdkilgleigaddyitkpfnpreltirarnllsrt
m

SCOP Domain Coordinates for d1xhfb1:

Click to download the PDB-style file with coordinates for d1xhfb1.
(The format of our PDB-style files is described here.)

Timeline for d1xhfb1: