Lineage for d1xcaa_ (1xca A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily)
barrel, closed or opened; n=8, S=12; meanderSuperfamily b.60.1: Lipocalins [50814] (10 families) 
bind hydrophobic ligands in their interior
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
ten-stranded meander beta-sheet folded upon itself
relates to the common fold by opening the barrel and insertion of beta-hairpin
Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species) Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (76 PDB entries) 
Domain d1xcaa_: 1xca A: [27205]
Details for d1xcaa_
PDB Entry: 1xca (more details), 2.3 Å
PDB Description: apo-cellular retinoic acid binding protein ii
PDB Compounds: (A:) cellular retinoic acid binding protein type IISCOPe Domain Sequences for d1xcaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcaa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II [TaxId: 9606]}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtmeltndgeli
ltmtaddvvctrvyvre
SCOPe Domain Coordinates for d1xcaa_:
Click to download the PDB-style file with coordinates for d1xcaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xcaa_:
- d1xcaa_ first appeared (with stable ids) in SCOP 1.55
- d1xcaa_ appears in SCOPe 2.07
View in 3D
