Lineage for d1x1oa2 (1x1o A:117-286)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101496Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2101568Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 2101569Protein automated matches [226879] (8 species)
    not a true protein
  7. 2101597Species Thermus thermophilus HB8 [TaxId:300852] [225063] (1 PDB entry)
  8. 2101598Domain d1x1oa2: 1x1o A:117-286 [203072]
    Other proteins in same PDB: d1x1oa1, d1x1ob1, d1x1oc1
    automated match to d1qapa1

Details for d1x1oa2

PDB Entry: 1x1o (more details), 1.9 Å

PDB Description: Crystal structure of project ID TT0268 from Thermus thermophilus HB8
PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d1x1oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1oa2 c.1.17.0 (A:117-286) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
iatltrayvealagtkaqildtrkttpglralekyavrvgggrnhryglfdgillkenhv
raaggvgeavrrakaraphylkvevevrsleeleealeagadlilldnfplealreavrr
vggrvpleasgnmtlerakaaaeagvdyvsvgalthsakaldlsllvvrp

SCOPe Domain Coordinates for d1x1oa2:

Click to download the PDB-style file with coordinates for d1x1oa2.
(The format of our PDB-style files is described here.)

Timeline for d1x1oa2:

2101598
d1x1oa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1x1oa1