Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins) automatically mapped to Pfam PF01255 |
Protein automated matches [190121] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [186844] (9 PDB entries) |
Domain d1x07a_: 1x07 A: [121545] automated match to d1jp3a_ complexed with ipe, mg, po4 |
PDB Entry: 1x07 (more details), 2.2 Å
SCOPe Domain Sequences for d1x07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x07a_ c.101.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} seklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlya fssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksea ltagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapv dlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
Timeline for d1x07a_: