Lineage for d1x07a1 (1x07 A:13-240)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712075Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 712076Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (1 family) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 712077Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (1 protein)
  6. 712078Protein Undecaprenyl diphosphate synthase [64007] (2 species)
  7. 712079Species Escherichia coli [TaxId:562] [64009] (10 PDB entries)
  8. 712095Domain d1x07a1: 1x07 A:13-240 [121545]
    automatically matched to d1jp3a_
    complexed with ipe, mg, po4

Details for d1x07a1

PDB Entry: 1x07 (more details), 2.2 Å

PDB Description: Crystal structure of undecaprenyl pyrophosphate synthase in complex with Mg and IPP
PDB Compounds: (A:) Undecaprenyl pyrophosphate synthetase

SCOP Domain Sequences for d1x07a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x07a1 c.101.1.1 (A:13-240) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

SCOP Domain Coordinates for d1x07a1:

Click to download the PDB-style file with coordinates for d1x07a1.
(The format of our PDB-style files is described here.)

Timeline for d1x07a1: