Lineage for d1wwia1 (1wwi A:1-148)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2312571Family a.22.1.4: Bacterial histone-fold protein [101318] (3 proteins)
    duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer
    automatically mapped to Pfam PF09123
  6. 2312575Protein Hypothetical protein TTHA1479 [140402] (1 species)
  7. 2312576Species Thermus thermophilus [TaxId:274] [140403] (1 PDB entry)
    Uniprot Q5SI95 1-148
  8. 2312577Domain d1wwia1: 1wwi A:1-148 [121362]

Details for d1wwia1

PDB Entry: 1wwi (more details), 1.58 Å

PDB Description: Crystal structure of ttk003001566 from Thermus Thermophilus HB8
PDB Compounds: (A:) hypothetical protein TTHA1479

SCOPe Domain Sequences for d1wwia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]}
mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl
piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar
vlkeldpalknpqtehheraervfnlll

SCOPe Domain Coordinates for d1wwia1:

Click to download the PDB-style file with coordinates for d1wwia1.
(The format of our PDB-style files is described here.)

Timeline for d1wwia1: