| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.4: Bacterial histone-fold protein [101318] (3 proteins) duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer automatically mapped to Pfam PF09123 |
| Protein Hypothetical protein TTHA1479 [140402] (1 species) |
| Species Thermus thermophilus [TaxId:274] [140403] (1 PDB entry) Uniprot Q5SI95 1-148 |
| Domain d1wwia1: 1wwi A:1-148 [121362] |
PDB Entry: 1wwi (more details), 1.58 Å
SCOPe Domain Sequences for d1wwia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]}
mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl
piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar
vlkeldpalknpqtehheraervfnlll
Timeline for d1wwia1: