Lineage for d1wu3i_ (1wu3 I:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767022Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 767023Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 767210Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 767223Protein Interferon-beta [47309] (2 species)
  7. 767227Species Mouse (Mus musculus) [TaxId:10090] [47311] (2 PDB entries)
    Uniprot P01575 22-182
    CA-atoms only
  8. 767228Domain d1wu3i_: 1wu3 I: [114890]

Details for d1wu3i_

PDB Entry: 1wu3 (more details), 2.15 Å

PDB Description: crystal structure of recombinant murine interferon beta
PDB Compounds: (I:) Interferon beta

SCOP Domain Sequences for d1wu3i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wu3i_ a.26.1.3 (I:) Interferon-beta {Mouse (Mus musculus) [TaxId: 10090]}
inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq
nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy
ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfqn

SCOP Domain Coordinates for d1wu3i_:

Click to download the PDB-style file with coordinates for d1wu3i_.
(The format of our PDB-style files is described here.)

Timeline for d1wu3i_: