| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
| Protein Interferon-beta [47309] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [47311] (2 PDB entries) Uniprot P01575 22-182 CA-atoms only |
| Domain d1wu3i_: 1wu3 I: [114890] |
PDB Entry: 1wu3 (more details), 2.15 Å
SCOP Domain Sequences for d1wu3i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wu3i_ a.26.1.3 (I:) Interferon-beta {Mouse (Mus musculus) [TaxId: 10090]}
inykqlqlqertnirkcqelleqlngkinltyradfkipmemtekmqksytafaiqemlq
nvflvfrnnfsstgwnetivvrlldelhqqtvflktvleekqeerltwemsstalhlksy
ywrvqrylklmkynsyawmvvraeifrnfliirrltrnfqn
Timeline for d1wu3i_: