Lineage for d1wfwa_ (1wfw A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796359Protein Kalirin-9a [117147] (1 species)
  7. 796360Species Mouse (Mus musculus) [TaxId:10090] [117148] (1 PDB entry)
    Uniprot Q8BTT9 594-651
  8. 796361Domain d1wfwa_: 1wfw A: [114595]
    Structural genomics target
    mutant

Details for d1wfwa_

PDB Entry: 1wfw (more details)

PDB Description: solution structure of sh3 domain of mouse kalirin-9a protein
PDB Compounds: (A:) Kalirin-9a

SCOP Domain Sequences for d1wfwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgstmtvikdyyalkeneicvsqgevvqvlavnqqnmclvyqpasdhspaaegwv
pgsilapfsgpssg

SCOP Domain Coordinates for d1wfwa_:

Click to download the PDB-style file with coordinates for d1wfwa_.
(The format of our PDB-style files is described here.)

Timeline for d1wfwa_: