| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
| Family b.34.2.1: SH3-domain [50045] (39 proteins) |
| Protein Kalirin-9a [117147] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [117148] (1 PDB entry) Uniprot Q8BTT9 594-651 |
| Domain d1wfwa_: 1wfw A: [114595] Structural genomics target mutant |
PDB Entry: 1wfw (more details)
SCOP Domain Sequences for d1wfwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgstmtvikdyyalkeneicvsqgevvqvlavnqqnmclvyqpasdhspaaegwv
pgsilapfsgpssg
Timeline for d1wfwa_: