Lineage for d1w6ma_ (1w6m A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) 
Protein Galectin-1 [100925] (5 species) Species Human (Homo sapiens) [TaxId:9606] [101638] (33 PDB entries)
Uniprot P09382
Domain d1w6ma_: 1w6m A: [114273]
complexed with bme, gal, so4
Details for d1w6ma_
PDB Entry: 1w6m (more details), 2.3 Å
PDB Description: x-ray crystal structure of c2s human galectin-1 complexed with galactose
PDB Compounds: (A:) galectin-1SCOPe Domain Sequences for d1w6ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6ma_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd
SCOPe Domain Coordinates for d1w6ma_:
Click to download the PDB-style file with coordinates for d1w6ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w6ma_:
- d1w6ma_ first appeared in SCOP 1.71
- d1w6ma_ appears in SCOPe 2.07
View in 3D
