PDB entry 1w6m

View 1w6m on RCSB PDB site
Description: x-ray crystal structure of c2s human galectin-1 complexed with galactose
Class: sugar binding protein
Keywords: sugar binding protein, lectin, carbohydrate-binding protein
Deposited on 2004-08-19, released 2004-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (1)
      • engineered mutation (64)
    Domains in SCOPe 2.08: d1w6ma_
  • Chain 'B':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (1)
      • engineered mutation (64)
    Domains in SCOPe 2.08: d1w6mb_
  • Heterogens: BME, SO4, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6mA (A:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6mB (B:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd