Class a: All alpha proteins [46456] (289 folds) |
Fold a.186: KaiA/RbsU domain [101214] (1 superfamily) 4 helices; bundle, right-handed twist; right-handed superhelix |
Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) |
Family a.186.1.2: Phosphoserine phosphatase RsbU, N-terminal domain [109836] (2 proteins) forms a helix-swapped dimer that otherwise is similar to the KaiA domain dimer automatically mapped to Pfam PF08673 |
Protein Phosphoserine phosphatase RsbU, N-terminal domain [109837] (1 species) |
Species Bacillus subtilis [TaxId:1423] [109838] (1 PDB entry) Uniprot P40399 1-84 |
Domain d1w53a_: 1w53 A: [109175] complexed with gol, xe |
PDB Entry: 1w53 (more details), 1.6 Å
SCOPe Domain Sequences for d1w53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w53a_ a.186.1.2 (A:) Phosphoserine phosphatase RsbU, N-terminal domain {Bacillus subtilis [TaxId: 1423]} mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp slpedvfhsldflievmigygmay
Timeline for d1w53a_: