Lineage for d1w53a_ (1w53 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018474Fold a.186: KaiA/RbsU domain [101214] (1 superfamily)
    4 helices; bundle, right-handed twist; right-handed superhelix
  4. 2018475Superfamily a.186.1: KaiA/RbsU domain [101215] (2 families) (S)
  5. 2018493Family a.186.1.2: Phosphoserine phosphatase RsbU, N-terminal domain [109836] (2 proteins)
    forms a helix-swapped dimer that otherwise is similar to the KaiA domain dimer
    automatically mapped to Pfam PF08673
  6. 2018494Protein Phosphoserine phosphatase RsbU, N-terminal domain [109837] (1 species)
  7. 2018495Species Bacillus subtilis [TaxId:1423] [109838] (1 PDB entry)
    Uniprot P40399 1-84
  8. 2018496Domain d1w53a_: 1w53 A: [109175]
    complexed with gol, xe

Details for d1w53a_

PDB Entry: 1w53 (more details), 1.6 Å

PDB Description: kinase recruitment domain of the stress phosphatase rsbu
PDB Compounds: (A:) phosphoserine phosphatase rsbu

SCOPe Domain Sequences for d1w53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w53a_ a.186.1.2 (A:) Phosphoserine phosphatase RsbU, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp
slpedvfhsldflievmigygmay

SCOPe Domain Coordinates for d1w53a_:

Click to download the PDB-style file with coordinates for d1w53a_.
(The format of our PDB-style files is described here.)

Timeline for d1w53a_: