PDB entry 1w53

View 1w53 on RCSB PDB site
Description: Kinase recruitment domain of the stress phosphatase RsbU
Class: hydrolase
Keywords: phosphatase, stress, bacillus, kinase, hydrolase
Deposited on 2004-08-05, released 2004-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphoserine phosphatase rsbu
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40399 (0-83)
  Domains in SCOPe 2.06: d1w53a_
• Heterogens: GOL, XE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1w53A (A:)
  mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp
  slpedvfhsldflievmigygmay