Lineage for d1w0da_ (1w0d A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1619978Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1619979Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1619980Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1619981Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)
  7. 1619993Species Mycobacterium tuberculosis [TaxId:1773] [117725] (2 PDB entries)
    Uniprot P95313
  8. 1619994Domain d1w0da_: 1w0d A: [114060]
    complexed with so4

Details for d1w0da_

PDB Entry: 1w0d (more details), 1.65 Å

PDB Description: the high resolution structure of mycobacterium tuberculosis leub (rv2995c)
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1w0da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis [TaxId: 1773]}
msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
ehdaaarvdraveahlatrgserlatsdvgeriaaal

SCOPe Domain Coordinates for d1w0da_:

Click to download the PDB-style file with coordinates for d1w0da_.
(The format of our PDB-style files is described here.)

Timeline for d1w0da_: