Lineage for d1w0da_ (1w0d A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591543Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 591544Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families) (S)
    the constituent families form similar dimers
  5. 591545Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (3 proteins)
    the active site is between the two identical subunits
  6. 591546Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (9 species)
  7. 591556Species Mycobacterium tuberculosis [TaxId:1773] [117725] (1 PDB entry)
  8. 591557Domain d1w0da_: 1w0d A: [114060]

Details for d1w0da_

PDB Entry: 1w0d (more details), 1.65 Å

PDB Description: the high resolution structure of mycobacterium tuberculosis leub (rv2995c)

SCOP Domain Sequences for d1w0da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0da_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Mycobacterium tuberculosis}
msklaiiagdgigpevtaeavkvldavvpgvqktsydlgarrfhatgevlpdsvvaelrn
hdaillgaigdpsvpsgvlerglllrlrfeldhhinlrparlypgvasplsgnpgidfvv
vregtegpytgnggairvgtpnevatevsvntafgvrrvvadaferarrrrkhltlvhkt
nvltfagglwlrtvdevgecypdvevayqhvdaatihmitdpgrfdvivtdnlfgdiitd
laaavcggiglaasgnidatranpsmfepvhgsapdiagqgiadptaaimsvalllshlg
ehdaaarvdraveahlatrgserlatsdvgeriaaal

SCOP Domain Coordinates for d1w0da_:

Click to download the PDB-style file with coordinates for d1w0da_.
(The format of our PDB-style files is described here.)

Timeline for d1w0da_: