Lineage for d1vr3a1 (1vr3 A:1-179)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424192Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins)
    automatically mapped to Pfam PF03079
  6. 2424193Protein Acireductone dioxygenase [82192] (2 species)
  7. 2424196Species Mouse (Mus musculus) [TaxId:10090] [141601] (6 PDB entries)
    Uniprot Q99JT9 1-179
  8. 2424197Domain d1vr3a1: 1vr3 A:1-179 [120431]
    complexed with ipa, ni, unl

Details for d1vr3a1

PDB Entry: 1vr3 (more details), 2.06 Å

PDB Description: Crystal structure of Acireductone dioxygenase (13543033) from Mus musculus at 2.06 A resolution
PDB Compounds: (A:) Acireductone dioxygenase

SCOPe Domain Sequences for d1vr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]}
mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn
yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme
kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta

SCOPe Domain Coordinates for d1vr3a1:

Click to download the PDB-style file with coordinates for d1vr3a1.
(The format of our PDB-style files is described here.)

Timeline for d1vr3a1: