![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins) automatically mapped to Pfam PF03079 |
![]() | Protein Acireductone dioxygenase [82192] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141601] (6 PDB entries) Uniprot Q99JT9 1-179 |
![]() | Domain d1vr3a1: 1vr3 A:1-179 [120431] complexed with ipa, ni, unl |
PDB Entry: 1vr3 (more details), 2.06 Å
SCOPe Domain Sequences for d1vr3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta
Timeline for d1vr3a1: