Lineage for d1veab_ (1vea B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) 
automatically mapped to Pfam PF09021Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins) Protein Hut operon positive regulatory protein HutP [111066] (1 species)
an RNA-binding antitermination proteinSpecies Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries)
Uniprot P10943
Domain d1veab_: 1vea B: [108530]
complexed with hbn
Details for d1veab_
PDB Entry: 1vea (more details), 2.8 Å
PDB Description: crystal structure of hutp, an rna binding antitermination protein
PDB Compounds: (B:) Hut operon positive regulatory proteinSCOPe Domain Sequences for d1veab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veab_ d.275.1.1 (B:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
lygtigapikglehetfgvginhi
SCOPe Domain Coordinates for d1veab_:
Click to download the PDB-style file with coordinates for d1veab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1veab_:
- d1veab_ first appeared in SCOP 1.69
- d1veab_ appears in SCOPe 2.07
View in 3D
