SCOPe 2.07: Domain d1veab_: 1vea B:

Lineage for d1veab_ (1vea B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)
   automatically mapped to Pfam PF09021

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)

6. Protein Hut operon positive regulatory protein HutP [111066] (1 species)
   an RNA-binding antitermination protein

7. Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries)
   Uniprot P10943

8. Domain d1veab_: 1vea B: [108530]
   complexed with hbn

Details for d1veab_

PDB Entry: 1vea, 2.8 Å

PDB Description: crystal structure of hutp, an rna binding antitermination protein

PDB Compounds: (B:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1veab_:

Sequence; same for both SEQRES and ATOM records:

>d1veab_ d.275.1.1 (B:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
lygtigapikglehetfgvginhi

Timeline for d1veab_:

• d1veab_ first appeared in SCOP 1.69
  
• d1veab_ appears in SCOPe 2.06
  
• d1veab_ appears in the current release, SCOPe 2.08