SCOPe 2.08: Domain d1veaa_: 1vea A:

Lineage for d1veaa_ (1vea A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)
   automatically mapped to Pfam PF09021

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (2 proteins)

6. Protein Hut operon positive regulatory protein HutP [111066] (1 species)
   an RNA-binding antitermination protein

7. Species Bacillus subtilis [TaxId:1423] [111067] (5 PDB entries)
   Uniprot P10943

8. Domain d1veaa_: 1vea A: [108529]
   complexed with hbn

Details for d1veaa_

PDB Entry: 1vea, 2.8 Å

PDB Description: crystal structure of hutp, an rna binding antitermination protein

PDB Compounds: (A:) Hut operon positive regulatory protein

SCOPe Domain Sequences for d1veaa_:

Sequence; same for both SEQRES and ATOM records:

>d1veaa_ d.275.1.1 (A:) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
errigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi

Timeline for d1veaa_:

• d1veaa_ first appeared in SCOP 1.69
  
• d1veaa_ appears in SCOPe 2.07