Lineage for d1veaa_ (1vea A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516985Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 516986Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
  5. 516987Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein)
  6. 516988Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 516989Species Bacillus subtilis [TaxId:1423] [111067] (1 PDB entry)
  8. 516990Domain d1veaa_: 1vea A: [108529]

Details for d1veaa_

PDB Entry: 1vea (more details), 2.8 Å

PDB Description: crystal structure of hutp, an rna binding antitermination protein

SCOP Domain Sequences for d1veaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veaa_ d.275.1.1 (A:) Hut operon positive regulatory protein HutP {Bacillus subtilis}
errigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
ygtigapikglehetfgvginhi

SCOP Domain Coordinates for d1veaa_:

Click to download the PDB-style file with coordinates for d1veaa_.
(The format of our PDB-style files is described here.)

Timeline for d1veaa_: