Lineage for d1v29b_ (1v29 B:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) 
Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
contains irregular array of helices in the N-terminal extension
Protein Cobalt-containing nitrile hydratase [82067] (2 species) 
Species Bacillus smithii [TaxId:1479] [117166] (1 PDB entry)
Uniprot Q84FS6 # 85% sequence identity; Bacillus sp. RAPc8 TaxID: 218609
Domain d1v29b_: 1v29 B: [113494]
Other proteins in same PDB: d1v29a_
complexed with co
Details for d1v29b_
PDB Entry: 1v29 (more details), 2.6 Å
PDB Description: crystal structure of nitrile hydratase from a thermophile bacillus smithii
PDB Compounds: (B:) nitrile hydratase b chainSCOPe Domain Sequences for d1v29b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v29b_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]}
mngihdvggmdgfgkimyvkeeedtyfkhdwerltfglvagcmaqglgmkafdefrigie
kmrpvdyltssyyghwiatvaynlletgvldekeledrtqafmekpdtkiqrwenpklvk
vvekalleglspvrevssfprfevgeriktrnihptghtrfpryvrdkygvieevygahv
fpddaahrkgenpqylyrvrfdaeelwgvkqndsvyidlwegylepvsh
SCOPe Domain Coordinates for d1v29b_:
Click to download the PDB-style file with coordinates for d1v29b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1v29b_:
- d1v29b_ first appeared in SCOP 1.71
- d1v29b_ appears in SCOP 1.75
- d1v29b_ appears in SCOPe 2.02
- d1v29b_ appears in the current release, SCOPe 2.08
View in 3D
