![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
![]() | Protein Cobalt-containing nitrile hydratase [82067] (2 species) |
![]() | Species Bacillus smithii [TaxId:1479] [117166] (1 PDB entry) Uniprot Q84FS6 # 85% sequence identity; Bacillus sp. RAPc8 TaxID: 218609 |
![]() | Domain d1v29b_: 1v29 B: [113494] Other proteins in same PDB: d1v29a_ complexed with co |
PDB Entry: 1v29 (more details), 2.6 Å
SCOPe Domain Sequences for d1v29b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v29b_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]} mngihdvggmdgfgkimyvkeeedtyfkhdwerltfglvagcmaqglgmkafdefrigie kmrpvdyltssyyghwiatvaynlletgvldekeledrtqafmekpdtkiqrwenpklvk vvekalleglspvrevssfprfevgeriktrnihptghtrfpryvrdkygvieevygahv fpddaahrkgenpqylyrvrfdaeelwgvkqndsvyidlwegylepvsh
Timeline for d1v29b_: