Lineage for d1v29b_ (1v29 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783802Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2783803Protein Cobalt-containing nitrile hydratase [82067] (2 species)
  7. 2783804Species Bacillus smithii [TaxId:1479] [117166] (1 PDB entry)
    Uniprot Q84FS6 # 85% sequence identity; Bacillus sp. RAPc8 TaxID: 218609
  8. 2783805Domain d1v29b_: 1v29 B: [113494]
    Other proteins in same PDB: d1v29a_
    complexed with co

Details for d1v29b_

PDB Entry: 1v29 (more details), 2.6 Å

PDB Description: crystal structure of nitrile hydratase from a thermophile bacillus smithii
PDB Compounds: (B:) nitrile hydratase b chain

SCOPe Domain Sequences for d1v29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v29b_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]}
mngihdvggmdgfgkimyvkeeedtyfkhdwerltfglvagcmaqglgmkafdefrigie
kmrpvdyltssyyghwiatvaynlletgvldekeledrtqafmekpdtkiqrwenpklvk
vvekalleglspvrevssfprfevgeriktrnihptghtrfpryvrdkygvieevygahv
fpddaahrkgenpqylyrvrfdaeelwgvkqndsvyidlwegylepvsh

SCOPe Domain Coordinates for d1v29b_:

Click to download the PDB-style file with coordinates for d1v29b_.
(The format of our PDB-style files is described here.)

Timeline for d1v29b_: