SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1v29b_ (1v29 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046509Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2046547Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 protein domains)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2046548Protein Cobalt-containing nitrile hydratase [82067] (2 species)
  7. 2046549Species Bacillus smithii [TaxId:1479] [117166] (1 PDB entry)
    Uniprot Q84FS6 # 85% sequence identity; Bacillus sp. RAPc8 TaxID: 218609
  8. 2046550Domain d1v29b_: 1v29 B: [113494]
    Other proteins in same PDB: d1v29a_
    complexed with co

Details for d1v29b_

PDB Entry: 1v29 (more details), 2.6 Å

PDB Description: Crystal structure of Nitrile hydratase from a thermophile Bacillus smithii
PDB Compounds: (B:) nitrile hydratase b chain

SCOPe Domain Sequences for d1v29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v29b_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Bacillus smithii [TaxId: 1479]}
mngihdvggmdgfgkimyvkeeedtyfkhdwerltfglvagcmaqglgmkafdefrigie
kmrpvdyltssyyghwiatvaynlletgvldekeledrtqafmekpdtkiqrwenpklvk
vvekalleglspvrevssfprfevgeriktrnihptghtrfpryvrdkygvieevygahv
fpddaahrkgenpqylyrvrfdaeelwgvkqndsvyidlwegylepvsh

SCOPe Domain Coordinates for d1v29b_:

Click to download the PDB-style file with coordinates for d1v29b_.
(The format of our PDB-style files is described here.)

Timeline for d1v29b_: