|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection | 
|  | Superfamily a.25.1: Ferritin-like [47240] (9 families)  contains bimetal-ion centre in the middle of the bundle | 
|  | Family a.25.1.1: Ferritin [47241] (9 proteins) | 
|  | Protein Dodecameric ferritin homolog [47250] (13 species) | 
|  | Species Streptococcus suis [TaxId:1307] [101134] (4 PDB entries) | 
|  | Domain d1umng_: 1umn G: [99613] | 
PDB Entry: 1umn (more details), 1.95 Å
SCOP Domain Sequences for d1umng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umng_ a.25.1.1 (G:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme
eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa
lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
Timeline for d1umng_: