Lineage for d1uepa_ (1uep A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538457Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1538458Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1538459Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1538560Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)
  7. 1538561Species Human (Homo sapiens) [TaxId:9606] [101720] (5 PDB entries)
    Uniprot Q86UL8 412-522, 600-682, 774-865, 913-1015, 1141-1230
  8. 1538563Domain d1uepa_: 1uep A: [99270]
    structural genomics; third PDZ domain

Details for d1uepa_

PDB Entry: 1uep (more details)

PDB Description: solution structure of the third pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)
PDB Compounds: (A:) membrane associated guanylate kinase inverted-2 (magi-2)

SCOPe Domain Sequences for d1uepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgykeldvhlrrmesgfgfrilggdepgqpiligaviamgsadrdgrlhpgdelv
yvdgipvagkthryvidlmhhaarngqvnltvrrkvlsgpssg

SCOPe Domain Coordinates for d1uepa_:

Click to download the PDB-style file with coordinates for d1uepa_.
(The format of our PDB-style files is described here.)

Timeline for d1uepa_: