SCOP 1.67: Domain d1uepa_: 1uep A:

Lineage for d1uepa_ (1uep A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (24 proteins)

6. Protein Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) [101719] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101720] (4 PDB entries)

8. Domain d1uepa_: 1uep A: [99270]
   structural genomics; third PDZ domain

Details for d1uepa_

PDB Entry: 1uep

PDB Description: solution structure of the third pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)

SCOP Domain Sequences for d1uepa_:

Sequence; same for both SEQRES and ATOM records:

>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens)}
gssgssgykeldvhlrrmesgfgfrilggdepgqpiligaviamgsadrdgrlhpgdelv
yvdgipvagkthryvidlmhhaarngqvnltvrrkvlsgpssg

Timeline for d1uepa_:

• d1uepa_ is new in SCOP 1.67
  
• d1uepa_ appears in SCOP 1.69
  
• d1uepa_ appears in the current release, SCOPe 2.08, called d1uepa1