Lineage for d1udda_ (1udd A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282621Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1282622Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1282771Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 1282786Protein Hypothetical transcriptional regulator PH1161 [110028] (1 species)
  7. 1282787Species Pyrococcus horikoshii [TaxId:53953] [110029] (1 PDB entry)
    Uniprot O58873
  8. 1282788Domain d1udda_: 1udd A: [107776]

Details for d1udda_

PDB Entry: 1udd (more details), 2.15 Å

PDB Description: TenA homologue protein from P.horikoshii OT3
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d1udda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]}
mrvmitdklrrdseqiwkkifehpfvvqlysgtlplekfkfyvlqdfnylvgltralavi
sskaeyplmaelielardevtvevenyvkllkeldltledaikteptlvnsaymdfmlat
aykgniiegltallpcfwsyaeiaeyhkdklrdnpikiyrewgkvylsneylnlvgrlrk
iidssghsgydrlrrifitgskfelafwemawrgg

SCOPe Domain Coordinates for d1udda_:

Click to download the PDB-style file with coordinates for d1udda_.
(The format of our PDB-style files is described here.)

Timeline for d1udda_: