![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.3: TENA/THI-4 [101458] (9 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
![]() | Protein Hypothetical transcriptional regulator PH1161 [110028] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [110029] (1 PDB entry) Uniprot O58873 |
![]() | Domain d1udda_: 1udd A: [107776] |
PDB Entry: 1udd (more details), 2.15 Å
SCOPe Domain Sequences for d1udda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii [TaxId: 53953]} mrvmitdklrrdseqiwkkifehpfvvqlysgtlplekfkfyvlqdfnylvgltralavi sskaeyplmaelielardevtvevenyvkllkeldltledaikteptlvnsaymdfmlat aykgniiegltallpcfwsyaeiaeyhkdklrdnpikiyrewgkvylsneylnlvgrlrk iidssghsgydrlrrifitgskfelafwemawrgg
Timeline for d1udda_: