Lineage for d1udda_ (1udd A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448927Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 448928Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 448995Family a.132.1.3: TENA/THI-4 [101458] (4 proteins)
    Pfam 03070; HO-related family lacking the heme-binding site
  6. 448996Protein Hypothetical transcriptional regulator PH1161 [110028] (1 species)
  7. 448997Species Pyrococcus horikoshii [TaxId:70601] [110029] (1 PDB entry)
  8. 448998Domain d1udda_: 1udd A: [107776]

Details for d1udda_

PDB Entry: 1udd (more details), 2.15 Å

PDB Description: TenA homologue protein from P.horikoshii OT3

SCOP Domain Sequences for d1udda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udda_ a.132.1.3 (A:) Hypothetical transcriptional regulator PH1161 {Pyrococcus horikoshii}
mrvmitdklrrdseqiwkkifehpfvvqlysgtlplekfkfyvlqdfnylvgltralavi
sskaeyplmaelielardevtvevenyvkllkeldltledaikteptlvnsaymdfmlat
aykgniiegltallpcfwsyaeiaeyhkdklrdnpikiyrewgkvylsneylnlvgrlrk
iidssghsgydrlrrifitgskfelafwemawrgg

SCOP Domain Coordinates for d1udda_:

Click to download the PDB-style file with coordinates for d1udda_.
(The format of our PDB-style files is described here.)

Timeline for d1udda_: