Lineage for d1ucrb_ (1ucr B:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (2 proteins)
automatically mapped to Pfam PF08679Protein Dissimilatory sulfite reductase DsvD [101049] (1 species) Species Desulfovibrio vulgaris [TaxId:881] [101050] (1 PDB entry) 
Domain d1ucrb_: 1ucr B: [99189]
complexed with so4
Details for d1ucrb_
PDB Entry: 1ucr (more details), 1.2 Å
PDB Description: Three-dimensional crystal structure of dissimilatory sulfite reductase D (DsrD)
PDB Compounds: (B:) Protein dsvDSCOPe Domain Sequences for d1ucrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucrb_ a.4.5.45 (B:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagkqaaae
SCOPe Domain Coordinates for d1ucrb_:
Click to download the PDB-style file with coordinates for d1ucrb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ucrb_:
- d1ucrb_ first appeared in SCOP 1.67
- d1ucrb_ appears in SCOPe 2.06
- d1ucrb_ appears in the current release, SCOPe 2.08
View in 3D
