Lineage for d1ucra_ (1ucr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307549Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (2 proteins)
    automatically mapped to Pfam PF08679
  6. 2307550Protein Dissimilatory sulfite reductase DsvD [101049] (1 species)
  7. 2307551Species Desulfovibrio vulgaris [TaxId:881] [101050] (1 PDB entry)
  8. 2307552Domain d1ucra_: 1ucr A: [99188]
    complexed with so4

Details for d1ucra_

PDB Entry: 1ucr (more details), 1.2 Å

PDB Description: Three-dimensional crystal structure of dissimilatory sulfite reductase D (DsrD)
PDB Compounds: (A:) Protein dsvD

SCOPe Domain Sequences for d1ucra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucra_ a.4.5.45 (A:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagkqaaa

SCOPe Domain Coordinates for d1ucra_:

Click to download the PDB-style file with coordinates for d1ucra_.
(The format of our PDB-style files is described here.)

Timeline for d1ucra_: