Lineage for d1u3ia1 (1u3i A:4-84)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.0: automated matches [191312] (1 protein)
not a true familyProtein automated matches [190056] (188 species)
not a true protein
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries) 
Domain d1u3ia1: 1u3i A:4-84 [202924]
Other proteins in same PDB: d1u3ia2
automated match to d2f8fa2
complexed with gsh
Details for d1u3ia1
PDB Entry: 1u3i (more details), 1.89 Å
PDB Description: crystal structure of glutathione s-tranferase from schistosoma mansoni
PDB Compounds: (A:) glutathione s-transferase 28 kdaSCOPe Domain Sequences for d1u3ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ia1 c.47.1.0 (A:4-84) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
ehikviyfdgrgraesirmtlvaagvdyederisfqdwpkikptipggrlpavkvtddhg
hvkwmleslaiarymakkhhm
SCOPe Domain Coordinates for d1u3ia1:
Click to download the PDB-style file with coordinates for d1u3ia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u3ia1:
- d1u3ia1 first appeared in SCOPe 2.03
- d1u3ia1 appears in SCOPe 2.06
- d1u3ia1 appears in the current release, SCOPe 2.08
View in 3D
