![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (107 species) not a true protein |
![]() | Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (6 PDB entries) |
![]() | Domain d1u3ia1: 1u3i A:4-84 [202924] Other proteins in same PDB: d1u3ia2 automated match to d2f8fa2 complexed with gsh |
PDB Entry: 1u3i (more details), 1.89 Å
SCOPe Domain Sequences for d1u3ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u3ia1 c.47.1.0 (A:4-84) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} ehikviyfdgrgraesirmtlvaagvdyederisfqdwpkikptipggrlpavkvtddhg hvkwmleslaiarymakkhhm
Timeline for d1u3ia1: