Lineage for d1u35c1 (1u35 C:814-919)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1083047Protein macro-H2A.1, histone domain [140396] (1 species)
  7. 1083048Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries)
    Uniprot O75367 11-116
  8. 1083050Domain d1u35c1: 1u35 C:814-919 [119495]
    Other proteins in same PDB: d1u35a1, d1u35b1, d1u35d1, d1u35e1, d1u35f1, d1u35h1
    protein/DNA complex

Details for d1u35c1

PDB Entry: 1u35 (more details), 3 Å

PDB Description: crystal structure of the nucleosome core particle containing the histone domain of macroh2a
PDB Compounds: (C:) H2A histone family

SCOPe Domain Sequences for d1u35c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]}
ktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaardn
kkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk

SCOPe Domain Coordinates for d1u35c1:

Click to download the PDB-style file with coordinates for d1u35c1.
(The format of our PDB-style files is described here.)

Timeline for d1u35c1: