Lineage for d1tj1a1 (1tj1 A:89-261)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
multihelical; arraySuperfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) 
Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein) Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
includes the N-terminal swapping arm made of three helices; possible DNA-binding function
Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
Uniprot P09546 87-610
Domain d1tj1a1: 1tj1 A:89-261 [112434]
Other proteins in same PDB: d1tj1a2
complexed with 2op, fad
Details for d1tj1a1
PDB Entry: 1tj1 (more details), 2 Å
PDB Description: Crystal structure of E. coli PutA proline dehydrogenase domain (residues 86-669) complexed with L-lactate
PDB Compounds: (A:) Bifunctional putA proteinSCOPe Domain Sequences for d1tj1a1:
Sequence, based on SEQRES records: (download)
>d1tj1a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmv
qgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvna
atwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt
Sequence, based on observed residues (ATOM records): (download)
>d1tj1a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmg
valmclaeallripdkatrdalirkgvdmamrlmgeqfvt
SCOPe Domain Coordinates for d1tj1a1:
Click to download the PDB-style file with coordinates for d1tj1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tj1a1:
- d1tj1a1 first appeared in SCOP 1.71
- d1tj1a1 appears in SCOPe 2.07
View in 3D
