Lineage for d1tj1a1 (1tj1 A:89-261)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735944Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 2735945Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 2735946Family a.176.1.1: N-terminal domain of bifunctional PutA protein [81936] (1 protein)
  6. 2735947Protein N-terminal domain of bifunctional PutA protein [81937] (2 species)
    includes the N-terminal swapping arm made of three helices; possible DNA-binding function
  7. 2735951Species Escherichia coli [TaxId:562] [81938] (7 PDB entries)
    Uniprot P09546 87-610
  8. 2735955Domain d1tj1a1: 1tj1 A:89-261 [112434]
    Other proteins in same PDB: d1tj1a2
    complexed with 2op, fad

Details for d1tj1a1

PDB Entry: 1tj1 (more details), 2 Å

PDB Description: Crystal structure of E. coli PutA proline dehydrogenase domain (residues 86-669) complexed with L-lactate
PDB Compounds: (A:) Bifunctional putA protein

SCOPe Domain Sequences for d1tj1a1:

Sequence, based on SEQRES records: (download)

>d1tj1a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmv
qgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfvna
atwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d1tj1a1 a.176.1.1 (A:89-261) N-terminal domain of bifunctional PutA protein {Escherichia coli [TaxId: 562]}
svsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragmg
valmclaeallripdkatrdalirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d1tj1a1:

Click to download the PDB-style file with coordinates for d1tj1a1.
(The format of our PDB-style files is described here.)

Timeline for d1tj1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tj1a2