PDB entry 1tj1

View 1tj1 on RCSB PDB site
Description: Crystal structure of E. coli PutA proline dehydrogenase domain (residues 86-669) complexed with L-lactate
Class: oxidoreductase
Keywords: beta/alpha barrel, flavoenzyme, FAD, proline catabolism, L-lactate, OXIDOREDUCTASE
Deposited on 2004-06-03, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21600000000000003
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional putA protein
    Species: Escherichia coli [TaxId:562]
    Gene: PUTA, POAA, B1014
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tj1a1, d1tj1a2
  • Heterogens: FAD, 2OP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tj1A (A:)
    lpqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgra
    gmvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslf
    vnaatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvtgeti
    aealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpg
    isiklsalhprysraqydrvmeelyprlksltllarqydiginidaeesdrleisldlle
    klcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikra
    qmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyyp
    gqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengants
    fvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdlyghgrdnsagldla
    nehrlaslssallnsalqkwqalpmleqpvaagemspvinpaepsssvdklaaalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tj1A (A:)
    qsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgragm
    gvalmclaeallripdkatrdalirkgvdmamrlmgeqfvtgetiaealanarkleekgf
    rysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpgisiklsalhprysra
    qydrvmeelyprlksltllarqydiginidaeesdrleisldlleklcfepelagwngig
    fviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikraqmdglegypvytrkv
    ytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyypgqyefqclhgmgepl
    yeqvtgkvadgklnrpcriyapvgthetllaylvrrllengantsfvnriadtslpldel
    vadpvtaveklaqqegqtglphpkiplprd