Lineage for d1tfpa_ (1tfp A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common foldSuperfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) 
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
automatically mapped to Pfam PF00576Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
sandwich; 8 strands in 2 sheets
Species Chicken (Gallus gallus) [TaxId:9031] [49477] (1 PDB entry) 
Domain d1tfpa_: 1tfp A: [22623]
complexed with so4
Details for d1tfpa_
PDB Entry: 1tfp (more details), 2.9 Å
PDB Description: transthyretin (formerly known as prealbumin)
PDB Compounds: (A:) TransthyretinSCOPe Domain Sequences for d1tfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfpa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Chicken (Gallus gallus) [TaxId: 9031]}
cplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeiheltteeqfvegvy
rvefdtssywkglglspfheyadvvftandsghrhytiaallspfsysttavvs
SCOPe Domain Coordinates for d1tfpa_:
Click to download the PDB-style file with coordinates for d1tfpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfpa_:
- d1tfpa_ first appeared (with stable ids) in SCOP 1.55
- d1tfpa_ appears in SCOPe 2.07
View in 3D
