SCOPe 2.08: Domain d1tfpb_: 1tfp B:

Lineage for d1tfpb_ (1tfp B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Chicken (Gallus gallus) [TaxId:9031] [49477] (1 PDB entry)

8. Domain d1tfpb_: 1tfp B: [22624]
   complexed with so4

Details for d1tfpb_

PDB Entry: 1tfp, 2.9 Å

PDB Description: transthyretin (formerly known as prealbumin)

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d1tfpb_:

Sequence; same for both SEQRES and ATOM records:

>d1tfpb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Chicken (Gallus gallus) [TaxId: 9031]}
cplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeiheltteeqfvegvy
rvefdtssywkglglspfheyadvvftandsghrhytiaallspfsysttavvs

Timeline for d1tfpb_:

• d1tfpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tfpb_ appears in SCOPe 2.07