Lineage for d1tfpa_ (1tfp A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) 
Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein) Protein Transthyretin (synonym: prealbumin) [49474] (3 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [49477] (1 PDB entry) 
Domain d1tfpa_: 1tfp A: [22623]
Details for d1tfpa_
PDB Entry: 1tfp (more details), 2.9 Å
PDB Description: transthyretin (formerly known as prealbumin)
SCOP Domain Sequences for d1tfpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfpa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Chicken (Gallus gallus)}
cplmvkvldavrgspaanvavkvfkkaadgtwqdfatgkttefgeiheltteeqfvegvy
rvefdtssywkglglspfheyadvvftandsghrhytiaallspfsysttavvs
SCOP Domain Coordinates for d1tfpa_:
Click to download the PDB-style file with coordinates for d1tfpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tfpa_:
- d1tfpa_ appears in SCOP 1.57
- d1tfpa_ appears in the current release, SCOPe 2.08
View in 3D
