Lineage for d1sgua_ (1sgu A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (9 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
Domain d1sgua_: 1sgu A: [112079]
complexed with mk1; mutant
Details for d1sgua_
PDB Entry: 1sgu (more details), 1.9 Å
PDB Description: comparing the accumulation of active site and non-active site mutations in the hiv-1 protease
PDB Compounds: (A:) Pol polyproteinSCOPe Domain Sequences for d1sgua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgua_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
qipieicghkvigtvlvgptpanvigrnlmtqigctlnf
SCOPe Domain Coordinates for d1sgua_:
Click to download the PDB-style file with coordinates for d1sgua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sgua_:
- d1sgua_ first appeared in SCOP 1.71
- d1sgua_ appears in SCOPe 2.07
View in 3D
