SCOP 1.71: Domain d1sgua_: 1sgu A:

Lineage for d1sgua_ (1sgu A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)

8. Domain d1sgua_: 1sgu A: [112079]

Details for d1sgua_

PDB Entry: 1sgu, 1.9 Å

PDB Description: comparing the accumulation of active site and non-active site mutations in the hiv-1 protease

SCOP Domain Sequences for d1sgua_:

Sequence; same for both SEQRES and ATOM records:

>d1sgua_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
qipieicghkvigtvlvgptpanvigrnlmtqigctlnf

Timeline for d1sgua_:

• d1sgua_ is new in SCOP 1.71
  
• d1sgua_ appears in SCOP 1.73
  
• d1sgua_ appears in the current release, SCOPe 2.08