Lineage for d1se7a_ (1se7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737984Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 2737985Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
    automatically mapped to Pfam PF06440
  5. 2737986Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 2737987Protein Homolog of theta (HOT) [116866] (1 species)
  7. 2737988Species Bacteriophage P1 [TaxId:10678] [116867] (2 PDB entries)
    Uniprot Q71T70
  8. 2737991Domain d1se7a_: 1se7 A: [112074]

Details for d1se7a_

PDB Entry: 1se7 (more details)

PDB Description: solution structure of the e. coli bacteriophage p1 encoded hot protein: a homologue of the theta subunit of e. coli dna polymerase iii
PDB Compounds: (A:) homologue of the theta subunit of DNA polymerase III

SCOPe Domain Sequences for d1se7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se7a_ a.237.1.1 (A:) Homolog of theta (HOT) {Bacteriophage P1 [TaxId: 10678]}
mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy
rqlslqlpkgsdpayqkddavkk

SCOPe Domain Coordinates for d1se7a_:

Click to download the PDB-style file with coordinates for d1se7a_.
(The format of our PDB-style files is described here.)

Timeline for d1se7a_: