Lineage for d1se7a_ (1se7 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546391Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 546392Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
  5. 546393Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
    Pfam 06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 546394Protein Homolog of theta (HOT) [116866] (1 species)
  7. 546395Species Bacteriophage P1 [TaxId:10678] [116867] (1 PDB entry)
  8. 546396Domain d1se7a_: 1se7 A: [112074]

Details for d1se7a_

PDB Entry: 1se7 (more details)

PDB Description: solution structure of the e. coli bacteriophage p1 encoded hot protein: a homologue of the theta subunit of e. coli dna polymerase iii

SCOP Domain Sequences for d1se7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se7a_ a.237.1.1 (A:) Homolog of theta (HOT) {Bacteriophage P1}
mydwniaaksqeerdkvnvdlaasgvaykerlnipviaeqvareqpenlrtyfmerlrhy
rqlslqlpkgsdpayqkddavkk

SCOP Domain Coordinates for d1se7a_:

Click to download the PDB-style file with coordinates for d1se7a_.
(The format of our PDB-style files is described here.)

Timeline for d1se7a_: