Lineage for d1s5ug_ (1s5u G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1409953Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 1410009Protein Hypothetical protein YbgC [102901] (1 species)
  7. 1410010Species Escherichia coli [TaxId:562] [102902] (1 PDB entry)
  8. 1410017Domain d1s5ug_: 1s5u G: [98579]
    structural genomics
    complexed with edo, so4

Details for d1s5ug_

PDB Entry: 1s5u (more details), 1.7 Å

PDB Description: Crystal Structure of Hypothetical Protein EC709 from Escherichia coli
PDB Compounds: (G:) Protein ybgC

SCOPe Domain Sequences for d1s5ug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ug_ d.38.1.1 (G:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}
ttlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkm
tveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpr
alpksivaef

SCOPe Domain Coordinates for d1s5ug_:

Click to download the PDB-style file with coordinates for d1s5ug_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ug_: