Lineage for d1s3ob_ (1s3o B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
barrel, closed; n=5, S=10
Protein ssDNA-binding protein [50264] (4 species) 
Species Human (Homo sapiens), mitochondria [TaxId:9606] [50265] (2 PDB entries)
Uniprot Q04837
Domain d1s3ob_: 1s3o B: [105248]
has additional insertions and/or extensions that are not grouped together
missing some secondary structures that made up less than one-third of the common domain
Details for d1s3ob_
PDB Entry: 1s3o (more details), 2.47 Å
PDB Description: Human mitochondrial single strand DNA binding protein (hmSSB)
PDB Compounds: (B:) Single-stranded DNA-binding protein, mitochondrialSCOPe Domain Sequences for d1s3ob_:
Sequence, based on SEQRES records: (download)
>d1s3ob_ b.40.4.3 (B:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsgdsevyqlgdvsqkttwh
risvfrpglrdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniiflsd
Sequence, based on observed residues (ATOM records): (download)
>d1s3ob_ b.40.4.3 (B:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrskttwhrisvfrpglrdva
yqyvkkgsriylegkidygeymdknnvrrqattiiadniiflsd
SCOPe Domain Coordinates for d1s3ob_:
Click to download the PDB-style file with coordinates for d1s3ob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s3ob_:
- d1s3ob_ first appeared in SCOP 1.69
- d1s3ob_ appears in SCOPe 2.07
View in 3D
