Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest |
Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) |
Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins) Pfam PF01981; UPF0099 |
Protein Hypothetical protein AF2095 [117608] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [117609] (1 PDB entry) Uniprot O28185 |
Domain d1rzwa_: 1rzw A: [112001] Structural genomics target |
PDB Entry: 1rzw (more details)
SCOPe Domain Sequences for d1rzwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzwa_ c.131.1.1 (A:) Hypothetical protein AF2095 {Archaeoglobus fulgidus [TaxId: 2234]} mtlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvkslee llgikhkaeslglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpllklehhh hhh
Timeline for d1rzwa_: