Lineage for d1ry4a_ (1ry4 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1785943Protein GTPase-binding domain of the cell polarity protein par6 (Par-6B) [89315] (2 species)
  7. 1785944Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101716] (3 PDB entries)
    Uniprot O97111 156-253; Cg5884-pa
  8. 1785947Domain d1ry4a_: 1ry4 A: [98085]

Details for d1ry4a_

PDB Entry: 1ry4 (more details)

PDB Description: nmr structure of the crib-pdz module of par-6
PDB Compounds: (A:) cg5884-pa

SCOPe Domain Sequences for d1ry4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry4a_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gsktkapsisiphdfrqvsaiidvdivpethrrvrllkhgsdkplgfyirdgtsvrvtas
glekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnlii
tvkpanqr

SCOPe Domain Coordinates for d1ry4a_:

Click to download the PDB-style file with coordinates for d1ry4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ry4a_: