PDB entry 1ry4

View 1ry4 on RCSB PDB site
Description: NMR Structure of the CRIB-PDZ module of Par-6
Class: cell adhesion
Keywords: PDZ, CRIB, Cdc-42, Cell Polarization, Polarity adaptor complex, CELL ADHESION
Deposited on 2003-12-19, released 2004-03-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cg5884-pa
  Species: Drosophila melanogaster [TaxId:7227]
  Gene: Par-6
  Database cross-references and differences (RAF-indexed):
  • GB NP_573238 (2-127)
    • cloning artifact (0-1)
  Domains in SCOPe 2.05: d1ry4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ry4A (A:)
  gsktkapsisiphdfrqvsaiidvdivpethrrvrllkhgsdkplgfyirdgtsvrvtas
  glekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnlii
  tvkpanqr